PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004496472.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family Trihelix
Protein Properties Length: 578aa    MW: 66180.5 Da    PI: 6.468
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004496472.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix95.26e-3049133186
        trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                     rW++qe+laL+++r++m+  +r+++lk+plWeevs+k++e g++r++k+Ckek+en+ k++k++keg+++++se  +t+++fdql+
  XP_004496472.1  49 RWPRQETLALLKIRSDMDGVFRDSSLKGPLWEEVSRKLAELGYHRNAKKCKEKFENVYKYHKRTKEGKSGKKSEG-KTYRFFDQLQ 133
                     8********************************************************************985555.69******98 PP

2trihelix101.56.9e-32389474187
        trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                     rW+k+ev+aLi++r+++e +++++  k+plWe++s+ m++ g++r++k+Ckekwen+nk+ykk+ke++k+r  + s+tcpyf++lea
  XP_004496472.1 389 RWPKSEVHALIRIRTSLEPKYQENGPKAPLWEDISAGMQRLGYNRNSKRCKEKWENINKYYKKMKESNKQR-RDGSKTCPYFNELEA 474
                     8*********************************************************************8.67778*******985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.146108IPR001005SANT/Myb domain
PROSITE profilePS500906.73748106IPR017877Myb-like domain
PfamPF138371.5E-1948135No hitNo description
CDDcd122031.82E-2248113No hitNo description
SMARTSM007171.2386448IPR001005SANT/Myb domain
PfamPF138372.4E-22388475No hitNo description
PROSITE profilePS500906.946388446IPR017877Myb-like domain
CDDcd122031.68E-25388453No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 578 aa     Download sequence    Send to blast
MELGDATVMD SSSGEIVAPE VHDGGDEKGR NGGEEDDKMM NITGSGGNRW PRQETLALLK  60
IRSDMDGVFR DSSLKGPLWE EVSRKLAELG YHRNAKKCKE KFENVYKYHK RTKEGKSGKK  120
SEGKTYRFFD QLQALEKQFS LSSYPPTSKP QPNNNIVSLP TKPNNTTTIS HVPSTNPTTL  180
ISPSPPPPLP PPTNATTTPT LTNNKNNNNV QYSLPNMNLF STTTTSTSSS TASDEDLEEK  240
YRKKRKWKDY FRRLTREVLI KQEEMQKKFL EAIDKREREH MAQQDAWRVQ EMNRINKEHE  300
LLVQERSTTA AKNAAVIAFL QKLSGQQNST IQDNFIQPPP PPQPTPPESA QTPISQLQIQ  360
PHEPVTSNNN IVEIHQNNGH KSGGGASSRW PKSEVHALIR IRTSLEPKYQ ENGPKAPLWE  420
DISAGMQRLG YNRNSKRCKE KWENINKYYK KMKESNKQRR DGSKTCPYFN ELEALYKEKN  480
KTFHNNIIKS SEMMEPLMVQ PEQQWRPPTT ITTTQYDEEE KKKKNSNEVE AKEEDYDDND  540
DDEYDEGDSM EEEEEDEGGV NSRYEVMTNK LSPVDTVE
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00244DAPTransfer from AT1G76890Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2255461e-114AC225546.4 Medicago truncatula clone mth2-78i17, complete sequence.
GenBankBT1495341e-114BT149534.1 Medicago truncatula clone JCVI-FLMt-19J11 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004496472.10.0PREDICTED: trihelix transcription factor GT-2-like
SwissprotQ391171e-141TGT2_ARATH; Trihelix transcription factor GT-2
TrEMBLG7ICY90.0G7ICY9_MEDTR; Myb/SANT-like DNA-binding domain protein
STRINGGLYMA20G30650.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37334181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.15e-79Trihelix family protein